PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000151195
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 632aa    MW: 71695.2 Da    PI: 9.1042
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000151195genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.85.8e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
    MDP0000151195  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding33.59.5e-1160103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
    MDP0000151195  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-18557IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139212.5E-131070No hitNo description
CDDcd001672.48E-121053No hitNo description
SuperFamilySSF466894.67E-2133106IPR009057Homeodomain-like
CDDcd116598.43E-3155106No hitNo description
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-1458104IPR009057Homeodomain-like
PfamPF118314.1E-46420628IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 632 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACVKD ENYEPGDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRQR KRKRKGIDYN AEIPFEKKPP PGFYDVADED RPVEQPNFPT  240
TIEELEGKRR IDVEAQLRKQ DIAKNKIAQR QDAPSAILQA NKMNDPETVR KRSKLMLPAP  300
QISDNELEEI AKMGYANDLA AEEFAEGSGA TRALLANYSQ TPRLGMTPSR TPQRTPTGKG  360
DAIMMEAENL ARLRESQTPL LGGDNPELHP SDFSGVTPRK KEIQTPNMML TPSATPGGAG  420
LTPRTGLTPR IGMTPSRDSF GMTPKGTPIR DELRINEEID TPNSAKLEQR RNLQFGFGSL  480
PQPKNEYQIV VQPAPEDNEE PEEKIEEDMS DRLARERAEE EARQQALLRK RSKVLQRELP  540
RPPAASLELI RNSLIKADGD RSSFVPPTHI EQADEMVKAE LLSLLEHDNA KYPLTEKVDK  600
RKKKGSKRSA NGPSTVPVIE XFEEDELKDV CF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10632242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRQRKRKRK
2199204RKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008370738.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLM5WK140.0M5WK14_PRUPE; Uncharacterized protein
STRINGGLYMA20G36600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40723354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5